OMP anticorps (Middle Region)

N° du produit ABIN631184

Détail du produit anti-OMP anticorps

Antigène: OMP (Olfactory Marker Protein (OMP))

Épitope: Middle Region

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OMP est non-conjugé

Application: Western Blotting (WB)

Specificité: OMP antibody was raised against the middle region of OMP

Purification: Affinity purified

Immunogène: OMP antibody was raised using the middle region of OMP corresponding to a region with amino acids WRKEDSDAIDWNEADALEFGERLSDLAKIRKVMYFLVTFGEGVEPANLKA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OMP Blocking Peptide, catalog no. 33R-10003, is also available for use as a blocking control in assays to test for specificity of this OMP antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMP antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OMP

Antigène: OMP (Olfactory Marker Protein (OMP))

Autre désignation: OMP (OMP Produits)

Synonymes: anticorps omp, anticorps zgc:101697, anticorps xomp1, anticorps xomp2, anticorps omp2-A, anticorps MGC75776, anticorps OMP, anticorps zgc:114158, anticorps olfactory marker protein, anticorps olfactory marker protein b, anticorps olfactory marker protein L homeolog, anticorps olfactory marker protein S homeolog, anticorps olfactory marker protein a, anticorps Omp, anticorps OMP, anticorps ompb, anticorps omp.L, anticorps omp.S, anticorps omp, anticorps ompa

Sujet: Olfactory marker protein is uniquely associated with the mature olfactory receptor neurons in many vertebrate species from fish to man. The OMP gene structure and protein sequence are highly conserved between mouse, rat and human.

Poids moléculaire: 19 kDa (MW of target protein)