Peripherin anticorps (N-Term)

N° du produit ABIN631185

Cet anticorps anti-Peripherin est un anticorps Lapin Polyclonal détectant Peripherin dans WB. Adapté pour Humain, Rat et Souris.

Aperçu rapide pour Peripherin anticorps (N-Term) (ABIN631185)

Antigène: Peripherin (PRPH)

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Peripherin est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Peripherin anticorps

Épitope: N-Term

Specificité: PRPH antibody was raised against the N terminal of PRPH

Purification: Affinity purified

Immunogène: PRPH antibody was raised using the N terminal of PRPH corresponding to a region with amino acids RFANFIEKVRFLEQQNAALRGELSQARGQEPARADQLCQQELRELRRELE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PRPH Blocking Peptide, (ABIN5615584), is also available for use as a blocking control in assays to test for specificity of this PRPH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PRPH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Peripherin

Antigène: Peripherin (PRPH)

Autre désignation: PRPH

Sujet: This gene encodes a cytoskeletal protein found in neurons of the peripheral nervous system. The encoded protein is a type III intermediate filament protein with homology to other cytoskeletal proteins such as desmin.

Poids moléculaire: 54 kDa (MW of target protein)