NGRN anticorps (N-Term)

N° du produit ABIN631192

Détail du produit anti-NGRN anticorps

Antigène: NGRN (Neugrin, Neurite Outgrowth Associated (NGRN))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp NGRN est non-conjugé

Application: Western Blotting (WB)

Specificité: NGRN antibody was raised against the N terminal of NGRN

Purification: Affinity purified

Immunogène: NGRN antibody was raised using the N terminal of NGRN corresponding to a region with amino acids MAVTLSLLLGGRVCAAVTRCGFATRGVAGPGPIGREPDPDSDWEPEEREL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NGRN Blocking Peptide, catalog no. 33R-5804, is also available for use as a blocking control in assays to test for specificity of this NGRN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NGRN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur NGRN

Antigène: NGRN (Neugrin, Neurite Outgrowth Associated (NGRN))

Autre désignation: NGRN (NGRN Produits)

Synonymes: anticorps Ngrn, anticorps zgc:136784, anticorps dsc92, anticorps Neugrin, anticorps DKFZp469B131, anticorps DSC92, anticorps AW552001, anticorps neugrin, neurite outgrowth associated, anticorps ngrn, anticorps NGRN, anticorps Ngrn

Sujet: NGRN may be involved in neuronal differentiation.

Poids moléculaire: 32 kDa (MW of target protein)