OPTN anticorps (C-Term)

N° du produit ABIN631194

Cet anticorps anti-OPTN est un anticorps Lapin Polyclonal détectant OPTN dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour OPTN anticorps (C-Term) (ABIN631194)

Antigène: OPTN (Optineurin (OPTN))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OPTN est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-OPTN anticorps

Épitope: C-Term

Specificité: Optineurin antibody was raised against the C terminal of OPTN

Purification: Affinity purified

Immunogène: Optineurin antibody was raised using the C terminal of OPTN corresponding to a region with amino acids SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Optineurin Blocking Peptide, (ABIN5615129), is also available for use as a blocking control in assays to test for specificity of this Optineurin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OPTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OPTN

Antigène: OPTN (Optineurin (OPTN))

Autre désignation: Optineurin

Sujet: OPTN is the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor-alpha or Fas-ligand pathways to mediate apoptosis, inflammation or vasoconstriction. Optineurin may also function in cellular morphogenesis and membrane trafficking, vesicle trafficking, and transcription activation through its interactions with the RAB8, huntingtin, and transcription factor IIIA proteins.

Poids moléculaire: 66 kDa (MW of target protein)

Pathways: M Phase