OPTN anticorps (C-Term)

N° du produit ABIN631194

Détail du produit anti-OPTN anticorps

Antigène: OPTN (Optineurin (OPTN))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OPTN est non-conjugé

Application: Western Blotting (WB)

Specificité: Optineurin antibody was raised against the C terminal of OPTN

Purification: Affinity purified

Immunogène: Optineurin antibody was raised using the C terminal of OPTN corresponding to a region with amino acids SDQQAYLVQRGAEDRDWRQQRNIPIHSCPKCGEVLPDIDTLQIHVMDCII

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Optineurin Blocking Peptide, catalog no. 33R-8367, is also available for use as a blocking control in assays to test for specificity of this Optineurin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OPTN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OPTN

Antigène: OPTN (Optineurin (OPTN))

Autre désignation: Optineurin (OPTN Produits)

Synonymes: anticorps nrp, anticorps fip2, anticorps hip7, anticorps hypl, anticorps glc1e, anticorps tfiiia-intp, anticorps ALS12, anticorps FIP2, anticorps GLC1E, anticorps HIP7, anticorps HYPL, anticorps NRP, anticorps TFIIIA-INTP, anticorps Fip2, anticorps 4930441O07Rik, anticorps fj52f04, anticorps si:ch211-240l19.3, anticorps wu:fj52f04, anticorps zgc:66386, anticorps zgc:77868, anticorps optineurin, anticorps optineurin L homeolog, anticorps OPTN, anticorps optn, anticorps Optn, anticorps optn.L

Sujet: OPTN is the coiled-coil containing protein optineurin. Optineurin may play a role in normal-tension glaucoma and adult-onset primary open angle glaucoma. Optineurin interacts with adenovirus E3-14.7K protein and may utilize tumor necrosis factor-alpha or Fas-ligand pathways to mediate apoptosis, inflammation or vasoconstriction. Optineurin may also function in cellular morphogenesis and membrane trafficking, vesicle trafficking, and transcription activation through its interactions with the RAB8, huntingtin, and transcription factor IIIA proteins.

Poids moléculaire: 66 kDa (MW of target protein)

Pathways: M Phase