FAH anticorps

N° du produit ABIN631198

Cet anticorps Lapin Polyclonal détecte spécifiquement FAH dans WB. Il présente une réactivité avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour FAH anticorps (ABIN631198)

Antigène: FAH (Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FAH est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FAH anticorps

Purification: Affinity purified

Immunogène: FAH antibody was raised using a synthetic peptide corresponding to a region with amino acids SFIPVAEDSDFPIHNLPYGVFSTRGDPRPRIGVAIGDQILDLSIIKHLFT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FAH Blocking Peptide, (ABIN5613456), is also available for use as a blocking control in assays to test for specificity of this FAH antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAH antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FAH

Antigène: FAH (Fumarylacetoacetate Hydrolase (Fumarylacetoacetase) (FAH))

Autre désignation: FAH

Sujet: FAH is the last enzyme in the tyrosine catabolism pathway. FAH deficiency is associated with Type 1 hereditary tyrosinemia.

Poids moléculaire: 46 kDa (MW of target protein)