WDR6 anticorps (C-Term)

N° du produit ABIN631201

Cet anticorps Lapin Polyclonal détecte spécifiquement WDR6 dans WB et IHC. Il présente une réactivité envers Humain et Souris.

Aperçu rapide pour WDR6 anticorps (C-Term) (ABIN631201)

Antigène: WDR6 (WD Repeat Domain 6 (WDR6))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp WDR6 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-WDR6 anticorps

Épitope: C-Term

Specificité: WDR6 antibody was raised against the C terminal of WDR6

Purification: Affinity purified

Immunogène: WDR6 antibody was raised using the C terminal of WDR6 corresponding to a region with amino acids TPSLTLQAHSCGINSLHTLPTREGHHLVASGSEDGSLHVFVLAVEMLQLE

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

WDR6 Blocking Peptide, (ABIN5617001), is also available for use as a blocking control in assays to test for specificity of this WDR6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of WDR6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur WDR6

Antigène: WDR6 (WD Repeat Domain 6 (WDR6))

Autre désignation: WDR6

Sujet: WDR6 is a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation.

Poids moléculaire: 53 kDa (MW of target protein)