AMD1 anticorps (N-Term)

N° du produit ABIN631207

Détail du produit anti-AMD1 anticorps

Antigène: AMD1 (Adenosylmethionine Decarboxylase 1 (AMD1))

Épitope: N-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp AMD1 est non-conjugé

Application: Western Blotting (WB)

Specificité: AMD1 antibody was raised against the N terminal of AMD1

Purification: Affinity purified

Immunogène: AMD1 antibody was raised using the N terminal of AMD1 corresponding to a region with amino acids MGRMNSDCWYLYTLDFPESRVISQPDQTLEILMSELDPAVMDQFYMKDGV

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

AMD1 Blocking Peptide, catalog no. 33R-6068, is also available for use as a blocking control in assays to test for specificity of this AMD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of AMD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur AMD1

Antigène: AMD1 (Adenosylmethionine Decarboxylase 1 (AMD1))

Autre désignation: AMD1 (AMD1 Produits)

Synonymes: anticorps ADOMETDC, anticorps AMD, anticorps SAMDC, anticorps Amd1a, anticorps Amd1b, anticorps AMD1, anticorps AdoMetDC, anticorps amd, anticorps samdc, anticorps fb26e03, anticorps si:ch211-257g8.2, anticorps wu:fb26e03, anticorps zgc:55614, anticorps 1, anticorps Amd-1, anticorps SAMDC 1, anticorps adoMetDC1, anticorps CG5029, anticorps Dmel\\CG5029, anticorps l(2)31Dc, anticorps l(2)31Dd, anticorps l(2)31De, anticorps F16B3.10, anticorps F16B3_10, anticorps S-ADENOSYLMETHIONINE DECARBOXYLASE, anticorps S-adenosylmethionine decarboxylase, anticorps adenosylmethionine decarboxylase 1, anticorps S-adenosylmethionine decarboxylase 1, anticorps S-adenosyl methionine decarboxylase 2, anticorps adenosylmethionine decarboxylase 1 L homeolog, anticorps S-adenosylmethionine decarboxylase, anticorps AMD1, anticorps Amd1, anticorps amd1, anticorps sam2, anticorps amd1.L, anticorps SamDC, anticorps SAMDC

Sujet: The specific function of AMD1 is not yet known.

Poids moléculaire: 21 kDa (MW of target protein)

Pathways: Ribonucleoside Biosynthetic Process