COTL1 anticorps

N° du produit ABIN631212

Détail du produit anti-COTL1 anticorps

Antigène: COTL1 (Coactosin-Like Protein)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp COTL1 est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: Coactosin-Like 1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQ

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Coactosin-Like 1 Blocking Peptide, catalog no. 33R-5779, is also available for use as a blocking control in assays to test for specificity of this Coactosin-Like 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of COTL1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur COTL1

Antigène: COTL1 (Coactosin-Like Protein)

Autre désignation: Coactosin-Like 1 (COTL1 Produits)

Synonymes: anticorps CLP, anticorps 1810074P22Rik, anticorps 2010004C08Rik, anticorps Clp, anticorps coactosin like F-actin binding protein 1, anticorps coactosin-like 1 (Dictyostelium), anticorps coactosin-like F-actin binding protein 1, anticorps COTL1, anticorps Cotl1

Sujet: This gene encodes one of the numerous actin-binding proteins which regulate the actin cytoskeleton. This protein binds F-actin, and also interacts with 5-lipoxygenase, which is the first committed enzyme in leukotriene biosynthesis.

Poids moléculaire: 16 kDa (MW of target protein)