PFN1 anticorps (N-Term)

N° du produit ABIN631215

Cet anticorps anti-PFN1 est un anticorps Lapin Polyclonal détectant PFN1 dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour PFN1 anticorps (N-Term) (ABIN631215)

Antigène: PFN1 (Profilin 1 (PFN1))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PFN1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PFN1 anticorps

Épitope: N-Term

Specificité: Profilin 1 antibody was raised against the N terminal of PFN1

Purification: Affinity purified

Immunogène: Profilin 1 antibody was raised using the N terminal of PFN1 corresponding to a region with amino acids AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Profilin 1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this Profilin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PFN1

Antigène: PFN1 (Profilin 1 (PFN1))

Autre désignation: Profilin 1

Sujet: PFN1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome.

Poids moléculaire: 15 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization, Tube Formation, Maintenance of Protein Location