PFN1 anticorps (N-Term)

N° du produit ABIN631215

Détail du produit anti-PFN1 anticorps

Antigène: PFN1 (Profilin 1 (PFN1))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PFN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: Profilin 1 antibody was raised against the N terminal of PFN1

Purification: Affinity purified

Immunogène: Profilin 1 antibody was raised using the N terminal of PFN1 corresponding to a region with amino acids AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Profilin 1 Blocking Peptide, catalog no. 33R-1234, is also available for use as a blocking control in assays to test for specificity of this Profilin 1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PFN1

Antigène: PFN1 (Profilin 1 (PFN1))

Autre désignation: Profilin 1 (PFN1 Produits)

Synonymes: anticorps GmPRO1, anticorps GmPRO2, anticorps PRO1, anticorps Profilin-1, anticorps profilin-1, anticorps profilin, anticorps MGC130883, anticorps Profilin1, anticorps XProfilin1, anticorps sb:cb813, anticorps wu:fa91a03, anticorps ALS18, anticorps Pfn, anticorps F6F22.21, anticorps F6F22_21, anticorps PFN1, anticorps PROFILIN 1, anticorps profilin 1, anticorps profilin, anticorps profilin 1, anticorps profilin 1 L homeolog, anticorps profilin homolog 1, anticorps Profilin-1, anticorps PRO2, anticorps PFN1, anticorps pfn1.L, anticorps pfn1, anticorps Pfn1, anticorps PRF1, anticorps prf1, anticorps pfn-1

Sujet: PFN1 is a ubiquitous actin monomer-binding protein belonging to the profilin family. It is thought to regulate actin polymerization in response to extracellular signals. Deletion of this gene is associated with Miller-Dieker syndrome.

Poids moléculaire: 15 kDa (MW of target protein)

Pathways: Regulation of Actin Filament Polymerization, Tube Formation, Maintenance of Protein Location