GALT anticorps (C-Term)

N° du produit ABIN631216

Cet anticorps Lapin Polyclonal détecte spécifiquement GALT dans WB. Il présente une réactivité envers Humain, Rat et Souris.

Aperçu rapide pour GALT anticorps (C-Term) (ABIN631216)

Antigène: GALT (Galactose-1-Phosphate Uridylyltransferase (GALT))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GALT est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GALT anticorps

Épitope: C-Term

Specificité: GALT antibody was raised against the C terminal of GALT

Purification: Affinity purified

Immunogène: GALT antibody was raised using the C terminal of GALT corresponding to a region with amino acids LLRSATVRKFMVGYEMLAQAQRDLTPEQAAERLRALPEVHYHLGQKDRET

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

GALT Blocking Peptide, (ABIN5613721), is also available for use as a blocking control in assays to test for specificity of this GALT antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GALT antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GALT

Antigène: GALT (Galactose-1-Phosphate Uridylyltransferase (GALT))

Autre désignation: GALT

Sujet: Galactose-1-phosphate uridyl transferase (GALT) catalyzes the second step of the Leloir pathway of galactose metabolism, namely the conversion of UDP-glucose + galactose-1-phosphate to glucose-1-phosphate + UDP-galactose. The absence of this enzyme results in classic galactosemia in humans and can be fatal in the newborn period if lactose is not removed from the diet.

Poids moléculaire: 43 kDa (MW of target protein)