Ketohexokinase anticorps

N° du produit ABIN631217

L’anticorps anti-Ketohexokinase Polyclonal Lapin est utilisé pour la détection de Ketohexokinase dans des échantillons de Humain. Il a été validé pour WB et IHC.

Aperçu rapide pour Ketohexokinase anticorps (ABIN631217)

Antigène: Ketohexokinase (KHK)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Ketohexokinase est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Détail du produit anti-Ketohexokinase anticorps

Purification: Affinity purified

Immunogène: KHK antibody was raised using a synthetic peptide corresponding to a region with amino acids FQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRV

Information d'application

Indications d'application: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

KHK Blocking Peptide, (ABIN938422), is also available for use as a blocking control in assays to test for specificity of this KHK antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KHK antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Ketohexokinase

Antigène: Ketohexokinase (KHK)

Autre désignation: KHK

Sujet: KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.KHK encodes the gene ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The splice variant presented encodes the highly active form found in liver, renal cortex, and small intestine, while the alternate variant encodes the lower activity form found in most other tissues.

Poids moléculaire: 33 kDa (MW of target protein)