Ubiquilin 3 anticorps (N-Term)

N° du produit ABIN631218

Cet anticorps anti-Ubiquilin 3 est un anticorps Lapin Polyclonal détectant Ubiquilin 3 dans WB. Adapté pour Humain et Souris.

Aperçu rapide pour Ubiquilin 3 anticorps (N-Term) (ABIN631218)

Antigène: Ubiquilin 3 (UBQLN3)

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Ubiquilin 3 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Ubiquilin 3 anticorps

Épitope: N-Term

Specificité: Ubiquilin 3 antibody was raised against the N terminal of UBQLN3

Purification: Affinity purified

Immunogène: Ubiquilin 3 antibody was raised using the N terminal of UBQLN3 corresponding to a region with amino acids LMRQHVSVPEFVTQLIDDPFIPGLLSNTGLVRQLVLDNPHMQQLIQHNPE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Ubiquilin 3 Blocking Peptide, (ABIN5616883), is also available for use as a blocking control in assays to test for specificity of this Ubiquilin 3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UBQLN3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Ubiquilin 3

Antigène: Ubiquilin 3 (UBQLN3)

Autre désignation: Ubiquilin 3

Sujet: UBQLN3 is an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation.

Poids moléculaire: 72 kDa (MW of target protein)