TJAP1 anticorps

N° du produit ABIN631222

Cet anticorps Lapin Polyclonal détecte spécifiquement TJAP1 dans WB. Il présente une réactivité envers Humain, Rat et Souris.

Aperçu rapide pour TJAP1 anticorps (ABIN631222)

Antigène: TJAP1 (Tight Junction Associated Protein 1 (Peripheral) (TJAP1))

Reactivité: Humain, Rat, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TJAP1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TJAP1 anticorps

Purification: Affinity purified

Immunogène: TJAP1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MTSAAPAKKPYRKAPPEHRELRLEIPGSRLEQEEPLTDAERMKLLQEENE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TJAP1 Blocking Peptide, (ABIN5616615), is also available for use as a blocking control in assays to test for specificity of this TJAP1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TJAP1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TJAP1

Antigène: TJAP1 (Tight Junction Associated Protein 1 (Peripheral) (TJAP1))

Autre désignation: TJAP1

Sujet: TJAP1 interacts with DLG1. The exact function of TJAP1 remains unknown.

Poids moléculaire: 15 kDa (MW of target protein)