RAPSN anticorps (N-Term)

N° du produit ABIN631223

L’anticorps Lapin Polyclonal anti-RAPSN a été validé pour WB. Il convient pour détecter RAPSN dans des échantillons de Humain, Souris, Rat et Chien.

Aperçu rapide pour RAPSN anticorps (N-Term) (ABIN631223)

Antigène: RAPSN (Receptor-Associated Protein of The Synapse (RAPSN))

Reactivité: Humain, Souris, Rat, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RAPSN est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RAPSN anticorps

Épitope: N-Term

Specificité: RAPSN antibody was raised against the N terminal of RAPSN

Purification: Affinity purified

Immunogène: RAPSN antibody was raised using the N terminal of RAPSN corresponding to a region with amino acids MGQDQTKQQIEKGLQLYQSNQTEKALQVWTKVLEKSSDLMGRFRVLGCLV

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RAPSN Blocking Peptide, (ABIN5615759), is also available for use as a blocking control in assays to test for specificity of this RAPSN antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RAPSN antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RAPSN

Antigène: RAPSN (Receptor-Associated Protein of The Synapse (RAPSN))

Autre désignation: RAPSN

Sujet: RAPSN belongs to a family of proteins that are receptor associated proteins of the synapse. It contains a conserved cAMP-dependent protein kinase phosphorylation site. It is believed to play some role in anchoring or stabilizing the nicotinic acetylcholine receptor at synaptic sites. It may link the receptor to the underlying postsynaptic cytoskeleton, possibly by direct association with actin or spectrin.

Poids moléculaire: 39 kDa (MW of target protein)