ISYNA1 anticorps (N-Term)

N° du produit ABIN631226

Détail du produit anti-ISYNA1 anticorps

Antigène: ISYNA1 (Inositol-3-Phosphate Synthase 1 (ISYNA1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ISYNA1 est non-conjugé

Application: Western Blotting (WB)

Specificité: ISYNA1 antibody was raised against the N terminal of ISYNA1

Purification: Affinity purified

Immunogène: ISYNA1 antibody was raised using the N terminal of ISYNA1 corresponding to a region with amino acids LQEQLWPHMEALRPRPSVYIPEFIAANQSARADNLIPGSRAQQLEQIRRD

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ISYNA1 Blocking Peptide, catalog no. 33R-5306, is also available for use as a blocking control in assays to test for specificity of this ISYNA1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ISYNA1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ISYNA1

Antigène: ISYNA1 (Inositol-3-Phosphate Synthase 1 (ISYNA1))

Autre désignation: ISYNA1 (ISYNA1 Produits)

Synonymes: anticorps INO1, anticorps INOS, anticorps IPS, anticorps IPS 1, anticorps IPS-1, anticorps 1300017C10Rik, anticorps AU018670, anticorps IPS 1-A, anticorps MI-1-P synthase A, anticorps MIP synthase A, anticorps ino1, anticorps ino1-a, anticorps inos, anticorps ips, anticorps isyna1, anticorps isyna1-a, anticorps isyna1-b, anticorps IPS 1-B, anticorps MI-1-P synthase B, anticorps MIP synthase B, anticorps ino1-B, anticorps inositol-3-phosphate synthase 1, anticorps myo-inositol 1-phosphate synthase A1, anticorps inositol-3-phosphate synthase 1 S homeolog, anticorps inositol-3-phosphate synthase 1 L homeolog, anticorps ISYNA1, anticorps Isyna1, anticorps sce1804, anticorps isyna1.S, anticorps isyna1.L

Sujet: Myoinositol, the most common naturally occurring form of inositol, is a component of plasma membrane phospholipids and functions as a cell signaling molecule. ISYNA1 (EC 5.5.1.4), or IPS, is a rate-limiting enzyme that catalyzes the de novo synthesis of myoinositol 1-phosphate from glucose 6-phosphate.

Poids moléculaire: 61 kDa (MW of target protein)