TJP2 anticorps

N° du produit ABIN631228

Cet anticorps Lapin Polyclonal détecte spécifiquement TJP2 dans WB. Il présente une réactivité envers Humain et Chien.

Aperçu rapide pour TJP2 anticorps (ABIN631228)

Antigène: TJP2 (Tight Junction Protein 2 (Zona Occludens 2) (TJP2))

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TJP2 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TJP2 anticorps

Purification: Affinity purified

Immunogène: TJP2 antibody was raised using a synthetic peptide corresponding to a region with amino acids TVVPETNKEPRYQEDPPAPQPKAAPRTFLRPSPEDEAIYGPNTKMVRFKK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TJP2 Blocking Peptide, (ABIN5616618), is also available for use as a blocking control in assays to test for specificity of this TJP2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TJP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TJP2

Antigène: TJP2 (Tight Junction Protein 2 (Zona Occludens 2) (TJP2))

Autre désignation: TJP2

Sujet: Tight junction proteins (TJPs) belong to a family of membrane-associated guanylate kinase (MAGUK) homologs that are involved in the organization of epithelial and endothelial intercellular junctions. TJPs bind to the cytoplasmic C termini of junctional transmembrane proteins and link them to the actin cytoskeleton.

Poids moléculaire: 134 kDa (MW of target protein)