FERMT1 anticorps

N° du produit ABIN631240

Cet anticorps Lapin Polyclonal détecte spécifiquement FERMT1 dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour FERMT1 anticorps (ABIN631240)

Antigène: FERMT1 (Fermitin Family Member 1 (FERMT1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FERMT1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FERMT1 anticorps

Purification: Affinity purified

Immunogène: FERMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FERMT1 Blocking Peptide, (ABIN5613571), is also available for use as a blocking control in assays to test for specificity of this FERMT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FERMT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FERMT1

Antigène: FERMT1 (Fermitin Family Member 1 (FERMT1))

Autre désignation: FERMT1

Sujet: FERMT1 is involved in cell adhesion, possibly via its interaction with integrins. It may mediate TGF-beta 1 signaling in tumor progression. Defects in FERMT1 are the cause of Kindler syndrome.

Poids moléculaire: 77 kDa (MW of target protein)