FERMT1 anticorps
-
- Antigène Voir toutes FERMT1 Anticorps
- FERMT1 (Fermitin Family Member 1 (FERMT1))
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FERMT1 est non-conjugé
-
Application
- Western Blotting (WB)
- Purification
- Affinity purified
- Immunogène
- FERMT1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LSSTDFTFASWELVVRVDHPNEEQQKDVTLRVSGDLHVGGVMLKLVEQIN
- Top Product
- Discover our top product FERMT1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FERMT1 Blocking Peptide, catalog no. 33R-5456, is also available for use as a blocking control in assays to test for specificity of this FERMT1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FERMT1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
- Avoid repeated freeze/thaw cycles.
- Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FERMT1 (Fermitin Family Member 1 (FERMT1))
- Autre désignation
- FERMT1 (FERMT1 Produits)
- Synonymes
- anticorps C20orf42, anticorps DTGCU2, anticorps KIND1, anticorps UNC112A, anticorps URP1, anticorps 5830467P10Rik, anticorps Kindlin-1, anticorps RGD1306816, anticorps si:ch73-22c10.1, anticorps wu:fc32b07, anticorps fermitin family member 1, anticorps fermitin family member 1 S homeolog, anticorps fermitin family homolog 1, anticorps FERMT1, anticorps Fermt1, anticorps fermt1.S, anticorps fermt1, anticorps LOC100548276
- Sujet
- FERMT1 is involved in cell adhesion, possibly via its interaction with integrins. It may mediate TGF-beta 1 signaling in tumor progression. Defects in FERMT1 are the cause of Kindler syndrome.
- Poids moléculaire
- 77 kDa (MW of target protein)
-