ACP6 anticorps (N-Term)

N° du produit ABIN631247

L’anticorps Lapin Polyclonal anti-ACP6 a été validé pour WB. Il convient pour détecter ACP6 dans des échantillons de Humain et Souris.

Aperçu rapide pour ACP6 anticorps (N-Term) (ABIN631247)

Antigène: ACP6 (Acid Phosphatase 6, Lysophosphatidic (ACP6))

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp ACP6 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-ACP6 anticorps

Épitope: N-Term

Specificité: ACP6 antibody was raised against the N terminal of ACP6

Purification: Affinity purified

Immunogène: ACP6 antibody was raised using the N terminal of ACP6 corresponding to a region with amino acids EADGQCPVDRSLLKLKMVQVVFRHGARSPLKPLPLEEQVEWNPQLLEVPP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ACP6 Blocking Peptide, (ABIN937639), is also available for use as a blocking control in assays to test for specificity of this ACP6 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP6 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur ACP6

Antigène: ACP6 (Acid Phosphatase 6, Lysophosphatidic (ACP6))

Autre désignation: ACP6

Sujet: ACP6 could hydrolyze lysophosphatidic acid to monoacylglycerol. It was originally reported to be located in the mitochondrion, but the evidence seems to be weak and contradictory with the presence of a cleaved signal sequence.

Poids moléculaire: 49 kDa (MW of target protein)