EHD4 anticorps (Middle Region)

N° du produit ABIN631253

Détail du produit anti-EHD4 anticorps

Antigène: EHD4 (EH-Domain Containing 4 (EHD4))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp EHD4 est non-conjugé

Application: Western Blotting (WB)

Specificité: EHD4 antibody was raised against the middle region of EHD4

Purification: Affinity purified

Immunogène: EHD4 antibody was raised using the middle region of EHD4 corresponding to a region with amino acids KAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPT

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

EHD4 Blocking Peptide, catalog no. 33R-4251, is also available for use as a blocking control in assays to test for specificity of this EHD4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of EHD4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur EHD4

Antigène: EHD4 (EH-Domain Containing 4 (EHD4))

Autre désignation: EHD4 (EHD4 Produits)

Synonymes: anticorps EHD4, anticorps past4, anticorps PAST4, anticorps 2210022F10Rik, anticorps AI197390, anticorps AI846352, anticorps AV006278, anticorps Past2, anticorps EH domain containing 4, anticorps EH-domain containing 4, anticorps EH domain containing 4 L homeolog, anticorps EHD4, anticorps ehd4, anticorps ehd4.L, anticorps Ehd4

Sujet: EHD4 is involved in the control of trafficking at the early endosome and regulates exit of cargo toward both the recycling compartment and the late endocytic pathway.

Poids moléculaire: 61 kDa (MW of target protein)