TEX14 anticorps (C-Term)

N° du produit ABIN631261

Détail du produit anti-TEX14 anticorps

Antigène: TEX14 (Testis Expressed 14 (TEX14))

Épitope: C-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TEX14 est non-conjugé

Application: Western Blotting (WB)

Specificité: TEX14 antibody was raised against the C terminal of TEX14

Purification: Affinity purified

Immunogène: TEX14 antibody was raised using the C terminal of TEX14 corresponding to a region with amino acids ASSDTLVAVEKSYSTSSPIEEDFEGIQGAFAQPQVSGEEKFQMRKILGKN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TEX14 Blocking Peptide, catalog no. 33R-1529, is also available for use as a blocking control in assays to test for specificity of this TEX14 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TEX14 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TEX14

Antigène: TEX14 (Testis Expressed 14 (TEX14))

Autre désignation: TEX14 (TEX14 Produits)

Synonymes: anticorps CT113, anticorps C85585, anticorps testis expressed 14, intercellular bridge forming factor, anticorps testis expressed gene 14, anticorps inactive serine/threonine-protein kinase TEX14, anticorps TEX14, anticorps Tex14, anticorps tex14, anticorps LOC100389169

Sujet: TEX14 belongs to the protein kinase superfamily. It contains 3 ANK repeats and 1 protein kinase domain. TEX14 is required for spermatogenesis and male fertility. It may be required for normal structure of the intercellular bridge that connects spermatocytes and spermatogonia. It has no protein kinase activity. This gene is similar to a mouse gene that is expressed in the testis.

Poids moléculaire: 160 kDa (MW of target protein)

Pathways: Maintenance of Protein Location