PFAS anticorps

N° du produit ABIN631263

Détail du produit anti-PFAS anticorps

Antigène: PFAS (Phosphoribosylformylglycinamidine Synthase (PFAS))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PFAS est non-conjugé

Application: Western Blotting (WB)

Purification: Affinity purified

Immunogène: PFAS antibody was raised using a synthetic peptide corresponding to a region with amino acids ESIMSTQESSNPNNVLKFCDNSSAIQGKEVRFLRPEDPTRPSRFQQQQGL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PFAS Blocking Peptide, catalog no. 33R-2731, is also available for use as a blocking control in assays to test for specificity of this PFAS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PFAS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PFAS

Antigène: PFAS (Phosphoribosylformylglycinamidine Synthase (PFAS))

Autre désignation: PFAS (PFAS Produits)

Synonymes: anticorps FGAMS, anticorps FGARAT, anticorps PURL, anticorps 4432409B16Rik, anticorps Gm18, anticorps Sofa, anticorps phosphoribosylformylglycinamidine synthase, anticorps phosphoribosylformylglycinamidine synthase (FGAR amidotransferase), anticorps Spirs_3128, anticorps PFAS, anticorps Pfas

Sujet: Purines are necessary for many cellular processes, including DNA replication, transcription, and energy metabolism. Ten enzymatic steps are required to synthesize inosine monophosphate (IMP) in the de novo pathway of purine biosynthesis. PFAS catalyzes the fourth step of IMP biosynthesis.

Poids moléculaire: 145 kDa (MW of target protein)