RHPN1 anticorps (Middle Region)
-
- Antigène Voir toutes RHPN1 Anticorps
- RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RHPN1 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- RHPN1 antibody was raised against the middle region of RHPN1
- Purification
- Affinity purified
- Immunogène
- RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP
- Top Product
- Discover our top product RHPN1 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RHPN1 Blocking Peptide, catalog no. 33R-8917, is also available for use as a blocking control in assays to test for specificity of this RHPN1 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHPN1 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))
- Autre désignation
- RHPN1 (RHPN1 Produits)
- Sujet
- RHPN1 has no enzymatic activity. RHPN1 may serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.
- Poids moléculaire
- 73 kDa (MW of target protein)
-