RHPN1 anticorps (Middle Region)

N° du produit ABIN631270

Détail du produit anti-RHPN1 anticorps

Antigène: RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RHPN1 est non-conjugé

Application: Western Blotting (WB)

Specificité: RHPN1 antibody was raised against the middle region of RHPN1

Purification: Affinity purified

Immunogène: RHPN1 antibody was raised using the middle region of RHPN1 corresponding to a region with amino acids SVLFNIGALHTQIGARQDRSCTEGARRAMEAFQRAAGAFSLLRENFSHAP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RHPN1 Blocking Peptide, catalog no. 33R-8917, is also available for use as a blocking control in assays to test for specificity of this RHPN1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RHPN1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RHPN1

Antigène: RHPN1 (Rhophilin, rho GTPase Binding Protein 1 (RHPN1))

Autre désignation: RHPN1 (RHPN1 Produits)

Sujet: RHPN1 has no enzymatic activity. RHPN1 may serve as a target for Rho, and interact with some cytoskeletal component upon Rho binding or relay a Rho signal to other molecules.

Poids moléculaire: 73 kDa (MW of target protein)