DDIT4L anticorps (Middle Region)

N° du produit ABIN631272

Cet anticorps anti-DDIT4L est un anticorps Lapin Polyclonal détectant DDIT4L dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour DDIT4L anticorps (Middle Region) (ABIN631272)

Antigène: DDIT4L (DNA-Damage-Inducible Transcript 4-Like (DDIT4L))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp DDIT4L est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-DDIT4L anticorps

Épitope: Middle Region

Specificité: DDIT4 L antibody was raised against the middle region of DDIT4

Purification: Affinity purified

Immunogène: DDIT4 L antibody was raised using the middle region of DDIT4 corresponding to a region with amino acids KLGCSKVLVPEKLTQRIAQDVLRLSSTEPCGLRGCVMHVNLEIENVCKKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

DDIT4L Blocking Peptide, (ABIN939895), is also available for use as a blocking control in assays to test for specificity of this DDIT4L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DDIT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur DDIT4L

Antigène: DDIT4L (DNA-Damage-Inducible Transcript 4-Like (DDIT4L))

Autre désignation: DDIT4L

Sujet: DDIT4L inhibits cell growth by regulating the FRAP1 pathway upstream of the TSC1-TSC2 complex and downstream of AKT1.

Poids moléculaire: 22 kDa (MW of target protein)