UNC45A anticorps

N° du produit ABIN631276

Cet anticorps Lapin Polyclonal détecte spécifiquement UNC45A dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour UNC45A anticorps (ABIN631276)

Antigène: UNC45A (Unc-45 Homolog A (UNC45A))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp UNC45A est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-UNC45A anticorps

Purification: Affinity purified

Immunogène: UNC45 A antibody was raised using a synthetic peptide corresponding to a region with amino acids REIASTLMESEMMEILSVLAKGDHSPVTRAAAACLDKAVEYGLIQPNQDG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

UNC45A Blocking Peptide, (ABIN5616909), is also available for use as a blocking control in assays to test for specificity of this UNC45A antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of UNC40 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur UNC45A

Antigène: UNC45A (Unc-45 Homolog A (UNC45A))

Autre désignation: UNC45A

Sujet: UNC45A plays a role in cell proliferation and myoblast fusion, binds progesterone receptor and HSP90, and acts as a regulator of the progesterone receptor chaperoning pathway.

Poids moléculaire: 102 kDa (MW of target protein)