PANK4 anticorps (N-Term)
-
- Antigène Voir toutes PANK4 Anticorps
- PANK4 (Pantothenate Kinase 4 (PANK4))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp PANK4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- PANK4 antibody was raised against the N terminal of PANK4
- Purification
- Affinity purified
- Immunogène
- PANK4 antibody was raised using the N terminal of PANK4 corresponding to a region with amino acids MAECGASGSGSSGDSLDKSITLPPDEIFRNLENAKRFAIDIGGSLTKLAY
- Top Product
- Discover our top product PANK4 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
PANK4 Blocking Peptide, catalog no. 33R-5630, is also available for use as a blocking control in assays to test for specificity of this PANK4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PANK4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- PANK4 (Pantothenate Kinase 4 (PANK4))
- Autre désignation
- PANK4 (PANK4 Produits)
- Synonymes
- anticorps zgc:66285, anticorps MGC142618, anticorps D030031I12Rik, anticorps R75150, anticorps Fang1, anticorps pantothenate kinase 4, anticorps pank4, anticorps PANK4, anticorps LOC100283180, anticorps Pank4
- Sujet
- This gene encodes a protein belonging to the pantothenate kinase family. Pantothenate kinase is a key regulatory enzyme in the biosynthesis of coenzyme A (CoA) in bacteria and mammalian cells.
- Poids moléculaire
- 86 kDa (MW of target protein)
- Pathways
- Ribonucleoside Biosynthetic Process
-