TYMS anticorps (C-Term)

N° du produit ABIN631290

Cet anticorps anti-TYMS est un anticorps Lapin Polyclonal détectant TYMS dans WB. Adapté pour Humain, Souris et Rat.

Aperçu rapide pour TYMS anticorps (C-Term) (ABIN631290)

Antigène: TYMS (Thymidylate Synthetase (TYMS))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TYMS est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-TYMS anticorps

Épitope: C-Term

Specificité: TYMS antibody was raised against the C terminal of TYMS

Purification: Affinity purified

Immunogène: TYMS antibody was raised using the C terminal of TYMS corresponding to a region with amino acids HIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TYMS Blocking Peptide, (ABIN939139), is also available for use as a blocking control in assays to test for specificity of this TYMS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYMS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TYMS

Antigène: TYMS (Thymidylate Synthetase (TYMS))

Autre désignation: TYMS

Sujet: TYMS catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases