TYMS anticorps (C-Term)

N° du produit ABIN631290

Détail du produit anti-TYMS anticorps

Antigène: TYMS (Thymidylate Synthetase (TYMS))

Épitope: C-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TYMS est non-conjugé

Application: Western Blotting (WB)

Specificité: TYMS antibody was raised against the C terminal of TYMS

Purification: Affinity purified

Immunogène: TYMS antibody was raised using the C terminal of TYMS corresponding to a region with amino acids HIEPLKIQLQREPRPFPKLRILRKVEKIDDFKAEDFQIEGYNPHPTIKME

Information d'application

Indications d'application: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TYMS Blocking Peptide, catalog no. 33R-3753, is also available for use as a blocking control in assays to test for specificity of this TYMS antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TYMS antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TYMS

Antigène: TYMS (Thymidylate Synthetase (TYMS))

Autre désignation: TYMS (TYMS Produits)

Synonymes: anticorps FN1, anticorps ECK2823, anticorps JW2795, anticorps ts, anticorps Ts, anticorps HST422, anticorps TMS, anticorps TS, anticorps thymidylate synthetase, anticorps contains intron in T4 phage, anticorps ThyE, anticorps thymidylate synthase, anticorps thymidylate synthetase L homeolog, anticorps TYMS, anticorps thyA, anticorps td, anticorps thyE, anticorps DDA3937_RS04960, anticorps tyms.L, anticorps XBJ1_RS15770, anticorps EAMY_RS20680, anticorps Tyms

Classe de substances: Viral Protein

Sujet: TYMS catalyzes the methylation of deoxyuridylate to deoxythymidylate using 5,10-methylenetetrahydrofolate (methylene-THF) as a cofactor. This function maintains the dTMP (thymidine-5-prime monophosphate) pool critical for DNA replication and repair. The enzyme has been of interest as a target for cancer chemotherapeutic agents. It is considered to be the primary site of action for 5-fluorouracil, 5-fluoro-2-prime-deoxyuridine, and some folate analogs.

Poids moléculaire: 36 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases