FIL1L anticorps (Middle Region)

N° du produit ABIN631303

Cet anticorps Lapin Polyclonal détecte spécifiquement FIL1L dans WB. Il présente une réactivité avec des échantillons de Humain.

Aperçu rapide pour FIL1L anticorps (Middle Region) (ABIN631303)

Antigène: FIL1L (FILIP1L) (Filamin A Interacting Protein 1-Like (FILIP1L))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FIL1L est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FIL1L anticorps

Épitope: Middle Region

Specificité: FILIP1 L antibody was raised against the middle region of FILIP1

Purification: Affinity purified

Immunogène: FILIP1 L antibody was raised using the middle region of FILIP1 corresponding to a region with amino acids KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FILIP1L Blocking Peptide, (ABIN940041), is also available for use as a blocking control in assays to test for specificity of this FILIP1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FILIP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FIL1L

Antigène: FIL1L (FILIP1L) (Filamin A Interacting Protein 1-Like (FILIP1L))

Autre désignation: FILIP1L

Sujet: FILIP1L acts as a regulator of the antiangiogenic activity on endothelial cells. When overexpressed in endothelial cells, FILIP1L leads to inhibition of cell proliferation and migration and an increase in apoptosis.

Poids moléculaire: 102 kDa (MW of target protein)