FIL1L anticorps (Middle Region)

N° du produit ABIN631303

Détail du produit anti-FIL1L anticorps

Antigène: FIL1L (FILIP1L) (Filamin A Interacting Protein 1-Like (FILIP1L))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FIL1L est non-conjugé

Application: Western Blotting (WB)

Specificité: FILIP1 L antibody was raised against the middle region of FILIP1

Purification: Affinity purified

Immunogène: FILIP1 L antibody was raised using the middle region of FILIP1 corresponding to a region with amino acids KSLRPSLNGRRISDPQVFSKEVQTEAVDNEPPDYKSLIPLERAVINGQLY

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FILIP1L Blocking Peptide, catalog no. 33R-4655, is also available for use as a blocking control in assays to test for specificity of this FILIP1L antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FILIP0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FIL1L

Antigène: FIL1L (FILIP1L) (Filamin A Interacting Protein 1-Like (FILIP1L))

Autre désignation: FILIP1L (FILIP1L Produits)

Synonymes: anticorps DOC-1, anticorps DOC1, anticorps GIP130, anticorps GIP130a, anticorps GIP130b, anticorps GIP130c, anticorps GIP90, anticorps 4631422O05Rik, anticorps Doc1, anticorps FILIP1L, anticorps filamin A interacting protein 1 like, anticorps filamin A interacting protein 1-like, anticorps FILIP1L, anticorps Filip1l, anticorps filip1l

Sujet: FILIP1L acts as a regulator of the antiangiogenic activity on endothelial cells. When overexpressed in endothelial cells, FILIP1L leads to inhibition of cell proliferation and migration and an increase in apoptosis.

Poids moléculaire: 102 kDa (MW of target protein)