Nitrilase 1 anticorps (N-Term)

N° du produit ABIN631305

Cet anticorps anti-Nitrilase 1 est un anticorps Lapin Polyclonal détectant Nitrilase 1 dans WB. Adapté pour Humain.

Aperçu rapide pour Nitrilase 1 anticorps (N-Term) (ABIN631305)

Antigène: Nitrilase 1 (NIT1)

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Nitrilase 1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-Nitrilase 1 anticorps

Épitope: N-Term

Specificité: NIT1 antibody was raised against the N terminal of NIT1

Purification: Affinity purified

Immunogène: NIT1 antibody was raised using the N terminal of NIT1 corresponding to a region with amino acids VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NIT1 Blocking Peptide, (ABIN5614998), is also available for use as a blocking control in assays to test for specificity of this NIT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Nitrilase 1

Antigène: Nitrilase 1 (NIT1)

Autre désignation: NIT1

Sujet: NIT1 play a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. NIT1 has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells.

Poids moléculaire: 36 kDa (MW of target protein)