Nitrilase 1 anticorps (N-Term)

N° du produit ABIN631305

Détail du produit anti-Nitrilase 1 anticorps

Antigène: Nitrilase 1 (NIT1)

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp Nitrilase 1 est non-conjugé

Application: Western Blotting (WB)

Specificité: NIT1 antibody was raised against the N terminal of NIT1

Purification: Affinity purified

Immunogène: NIT1 antibody was raised using the N terminal of NIT1 corresponding to a region with amino acids VREAARLGACLAFLPEAFDFIARDPAETLHLSEPLGGKLLEEYTQLAREC

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

NIT1 Blocking Peptide, catalog no. 33R-9769, is also available for use as a blocking control in assays to test for specificity of this NIT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of NIT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur Nitrilase 1

Antigène: Nitrilase 1 (NIT1)

Autre désignation: NIT1 (NIT1 Produits)

Synonymes: anticorps MGC85476, anticorps zgc:101630, anticorps ZmNIT1, anticorps DDBDRAFT_0217173, anticorps DDBDRAFT_0302491, anticorps DDB_0217173, anticorps DDB_0302491, anticorps AI255805, anticorps ESTM30, anticorps W57327, anticorps A. THALIANA NITRILASE 1, anticorps ATNIT1, anticorps NITI, anticorps NITRILE AMINOHYDROLASE, anticorps nitrilase 1, anticorps nitrilase 1 S homeolog, anticorps nitrilase 1, anticorps nit1.S, anticorps nit1, anticorps NIT1, anticorps nit1-2, anticorps Nit1

Sujet: NIT1 play a role in cell growth and apoptosis: loss of expression promotes cell growth and resistance to DNA damage stress. NIT1 has tumor suppressor properties that enhances the apoptotic responsiveness in cancer cells.

Poids moléculaire: 36 kDa (MW of target protein)