FBXL5 anticorps (Middle Region)

N° du produit ABIN631308

Détail du produit anti-FBXL5 anticorps

Antigène: FBXL5 (F-Box and Leucine-Rich Repeat Protein 5 (FBXL5))

Épitope: Middle Region

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXL5 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXL5 antibody was raised against the middle region of FBXL5

Purification: Affinity purified

Immunogène: FBXL5 antibody was raised using the middle region of FBXL5 corresponding to a region with amino acids LRTMSSLPESSAMCRKAARTRLPRGKDLIYFGSEKSDQETGRVLLFLSLS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXL5 Blocking Peptide, catalog no. 33R-5399, is also available for use as a blocking control in assays to test for specificity of this FBXL5 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXL5 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXL5

Antigène: FBXL5 (F-Box and Leucine-Rich Repeat Protein 5 (FBXL5))

Autre désignation: FBXL5 (FBXL5 Produits)

Synonymes: anticorps fbxl5, anticorps MGC53238, anticorps FBXL5, anticorps FBL4, anticorps FBL5, anticorps FLR1, anticorps Fbl4, anticorps Fir4, anticorps wu:fb52d06, anticorps F-box and leucine rich repeat protein 5, anticorps F-box and leucine-rich repeat protein 5 S homeolog, anticorps F-box and leucine-rich repeat protein 5 L homeolog, anticorps F-box and leucine-rich repeat protein 5, anticorps FBXL5, anticorps fbxl5.S, anticorps fbxl5.L, anticorps fbxl5, anticorps Fbxl5

Sujet: FBXL5 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination.

Poids moléculaire: 63 kDa (MW of target protein)

Pathways: Transition Metal Ion Homeostasis