OCIAD1 anticorps (C-Term)

N° du produit ABIN631311

Cet anticorps anti-OCIAD1 Polyclonal Lapin (ABIN631311) détecte spécifiquement OCIAD1 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour OCIAD1 anticorps (C-Term) (ABIN631311)

Antigène: OCIAD1 (OCIA Domain Containing 1 (OCIAD1))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp OCIAD1 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-OCIAD1 anticorps

Épitope: C-Term

Specificité: OCIAD1 antibody was raised against the C terminal of OCIAD1

Purification: Affinity purified

Immunogène: OCIAD1 antibody was raised using the C terminal of OCIAD1 corresponding to a region with amino acids QGPDPNLEESPKRKNITYEELRNKNRESYEVSLTQKTDPSVRPMHERVPK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

OCIAD1 Blocking Peptide, , is also available for use as a blocking control in assays to test for specificity of this OCIAD1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OCIAD1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur OCIAD1

Antigène: OCIAD1 (OCIA Domain Containing 1 (OCIAD1))

Autre désignation: OCIAD1

Sujet: OCIAD1 belongs to the OCIAD1 family. It contains 1 OCIA domain. OCIAD1 is over-expressed in metastatic ovarian cancer.

Poids moléculaire: 27 kDa (MW of target protein)