RNF165 anticorps (Middle Region)
-
- Antigène Voir toutes RNF165 Anticorps
- RNF165 (Ring Finger Protein 165 (RNF165))
-
Épitope
- Middle Region
-
Reactivité
- Humain, Souris, Rat, Chien
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp RNF165 est non-conjugé
-
Application
- Western Blotting (WB), Immunohistochemistry (IHC)
- Specificité
- RNF165 antibody was raised against the middle region of RNF165
- Purification
- Affinity purified
- Immunogène
- RNF165 antibody was raised using the middle region of RNF165 corresponding to a region with amino acids SSTQMVVHEIRNYPYPQLHFLALQGLNPSRHTSAVRESYEELLQLEDRLG
- Top Product
- Discover our top product RNF165 Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
RNF165 Blocking Peptide, catalog no. 33R-8857, is also available for use as a blocking control in assays to test for specificity of this RNF165 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF165 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- RNF165 (Ring Finger Protein 165 (RNF165))
- Autre désignation
- RNF165 (RNF165 Produits)
- Sujet
- RNF165 is encoded in regions involved in pericentric inversions in patients with bipolar affective disorder.
- Poids moléculaire
- 38 kDa (MW of target protein)
-