GNLY anticorps (N-Term)

N° du produit ABIN631324

Cet anticorps Lapin Polyclonal détecte spécifiquement GNLY dans WB. Il présente une réactivité envers Humain.

Aperçu rapide pour GNLY anticorps (N-Term) (ABIN631324)

Antigène: GNLY (Granulysin (GNLY))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp GNLY est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-GNLY anticorps

Épitope: N-Term

Specificité: Granulysin antibody was raised against the n terminal of GNLY

Purification: Affinity purified

Immunogène: Granulysin antibody was raised using the N terminal of GNLY corresponding to a region with amino acids MASGPLGPGARPTRLHPPFPPPAHIKPGAPPGENPELSGLERILARHQLP

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

Granulysin Blocking Peptide, (ABIN5613852), is also available for use as a blocking control in assays to test for specificity of this Granulysin antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNLY antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur GNLY

Antigène: GNLY (Granulysin (GNLY))

Autre désignation: Granulysin

Sujet: GNLY is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. GNLY is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms.

Poids moléculaire: 24 kDa (MW of target protein)