GNLY anticorps (N-Term)
-
- Antigène Voir toutes GNLY Anticorps
- GNLY (Granulysin (GNLY))
-
Épitope
- N-Term
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp GNLY est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- Granulysin antibody was raised against the n terminal of GNLY
- Purification
- Affinity purified
- Immunogène
- Granulysin antibody was raised using the N terminal of GNLY corresponding to a region with amino acids MASGPLGPGARPTRLHPPFPPPAHIKPGAPPGENPELSGLERILARHQLP
- Top Product
- Discover our top product GNLY Anticorps primaire
-
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
Granulysin Blocking Peptide, catalog no. 33R-5745, is also available for use as a blocking control in assays to test for specificity of this Granulysin antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GNLY antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- GNLY (Granulysin (GNLY))
- Autre désignation
- Granulysin (GNLY Produits)
- Synonymes
- anticorps 519, anticorps D2S69E, anticorps LAG-2, anticorps LAG2, anticorps NKG5, anticorps TLA519, anticorps granulysin, anticorps GNLY
- Sujet
- GNLY is a member of the saposin-like protein (SAPLIP) family and is located in the cytotoxic granules of T cells, which are released upon antigen stimulation. GNLY is present in cytotoxic granules of cytotoxic T lymphocytes and natural killer cells, and it has antimicrobial activity against M. tuberculosis and other organisms.
- Poids moléculaire
- 24 kDa (MW of target protein)
-