PDZRN4 anticorps (N-Term)

N° du produit ABIN631326

Cet anticorps anti-PDZRN4 Polyclonal Lapin (ABIN631326) détecte spécifiquement PDZRN4 dans WB. L’anticorps est réactif avec des échantillons de Humain.

Aperçu rapide pour PDZRN4 anticorps (N-Term) (ABIN631326)

Antigène: PDZRN4 (PDZ Domain Containing Ring Finger 4 (PDZRN4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp PDZRN4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-PDZRN4 anticorps

Épitope: N-Term

Specificité: PDZRN4 antibody was raised against the N terminal of PDZRN4

Purification: Affinity purified

Immunogène: PDZRN4 antibody was raised using the N terminal of PDZRN4 corresponding to a region with amino acids SDSCHSLHPMEHEFYEDNEYISSLPADADRTEDFEYEEVELCRVSSQEKL

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

PDZRN4 Blocking Peptide, (ABIN5615303), is also available for use as a blocking control in assays to test for specificity of this PDZRN4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PDZRN4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur PDZRN4

Antigène: PDZRN4 (PDZ Domain Containing Ring Finger 4 (PDZRN4))

Autre désignation: PDZRN4

Sujet: The function of PDZRN4 protein is not widely studied, and is yet to be elucidated fully.

Poids moléculaire: 89 kDa (MW of target protein)