LIPT1 anticorps (N-Term)

N° du produit ABIN631332

Détail du produit anti-LIPT1 anticorps

Antigène: LIPT1 (Lipoyltransferase 1 (LIPT1))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LIPT1 est non-conjugé

Application: Western Blotting (WB)

Specificité: LIPT1 antibody was raised against the N terminal of LIPT1

Purification: Affinity purified

Immunogène: LIPT1 antibody was raised using the N terminal of LIPT1 corresponding to a region with amino acids NCFQLLCNCQVPAAGFKKTVKNGLILQSISNDVYQNLAVEDWIHDHMNLE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LIPT1 Blocking Peptide, catalog no. 33R-6654, is also available for use as a blocking control in assays to test for specificity of this LIPT1 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LIPT1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LIPT1

Antigène: LIPT1 (Lipoyltransferase 1 (LIPT1))

Autre désignation: LIPT1 (LIPT1 Produits)

Synonymes: anticorps EG623661, anticorps lipoyltransferase 1, anticorps chromosome 10 C2orf15 homolog, anticorps LIPT1, anticorps MCYG_01144, anticorps MGYG_01698, anticorps C10H2orf15, anticorps Lipt1

Sujet: The process of transferring lipoic acid to proteins is a two-step process. The first step is the activation of lipoic acid by lipoate-activating enzyme to form lipoyl-AMP. For the second step, LIPT1 transfers the lipoyl moiety to apoproteins.

Poids moléculaire: 42 kDa (MW of target protein)