METTL2B anticorps (N-Term)

N° du produit ABIN631333

Détail du produit anti-METTL2B anticorps

Antigène: METTL2B (Methyltransferase Like 2B (METTL2B))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp METTL2B est non-conjugé

Application: Western Blotting (WB)

Specificité: METTL2 B antibody was raised against the N terminal of METTL2

Purification: Affinity purified

Immunogène: METTL2 B antibody was raised using the N terminal of METTL2 corresponding to a region with amino acids AGSYPEGAPAILADKRQQFGSRFLSDPARVFHHNAWDNVEWSEEQAAAAE

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

METTL2B Blocking Peptide, catalog no. 33R-1229, is also available for use as a blocking control in assays to test for specificity of this METTL2B antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of METTL0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur METTL2B

Antigène: METTL2B (Methyltransferase Like 2B (METTL2B))

Autre désignation: METTL2B (METTL2B Produits)

Synonymes: anticorps METL, anticorps METTL2, anticorps METTL2A, anticorps PSENIP1, anticorps Mettl2, anticorps methyltransferase like 2B, anticorps METTL2B, anticorps Mettl2b

Sujet: METTL2B is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. This gene is a member of a family of methyltransferases that share homology with, but are distinct from, the UbiE family of methyltransferases. Alternatively spliced variants which encode different protein isoforms have been described, however, not all variants have been fully characterized.

Poids moléculaire: 43 kDa (MW of target protein)