RNF160 anticorps (N-Term)

N° du produit ABIN631341

Cet anticorps anti-RNF160 est un anticorps Lapin Polyclonal détectant RNF160 dans WB. Adapté pour Humain.

Aperçu rapide pour RNF160 anticorps (N-Term) (ABIN631341)

Antigène: RNF160 (ZNF294) (Zinc Finger Protein 294 (ZNF294))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF160 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RNF160 anticorps

Épitope: N-Term

Specificité: ZNF294 antibody was raised against the N terminal of ZNF294

Purification: Affinity purified

Immunogène: ZNF294 antibody was raised using the N terminal of ZNF294 corresponding to a region with amino acids MGGKNKQRTKGNLRPSNSGRAAELLAKEQGTVPGFIGFGTSQSDLGYVPA

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZNF294 Blocking Peptide, (ABIN5617160), is also available for use as a blocking control in assays to test for specificity of this ZNF294 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF294 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF160

Antigène: RNF160 (ZNF294) (Zinc Finger Protein 294 (ZNF294))

Autre désignation: ZNF294

Sujet: ZNF294 may function as an E3 ubiquitin-protein ligase. E3 ubiquitin ligases accept ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a thioester and then directly transfer the ubiquitin to targeted substrates.

Poids moléculaire: 200 kDa (MW of target protein)