FBXW2 anticorps (Middle Region)

N° du produit ABIN631359

Détail du produit anti-FBXW2 anticorps

Antigène: FBXW2 (F-Box and WD Repeat Domain Containing 2 (FBXW2))

Épitope: Middle Region

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXW2 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXW2 antibody was raised against the middle region of FBXW2

Purification: Affinity purified

Immunogène: FBXW2 antibody was raised using the middle region of FBXW2 corresponding to a region with amino acids SLISRWPLPEYRKSKRGSSFLAGEASWLNGLDGHNDTGLVFATSMPDHSI

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXW2 Blocking Peptide, catalog no. 33R-8600, is also available for use as a blocking control in assays to test for specificity of this FBXW2 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXW2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXW2

Antigène: FBXW2 (F-Box and WD Repeat Domain Containing 2 (FBXW2))

Autre désignation: FBXW2 (FBXW2 Produits)

Synonymes: anticorps FBXW2, anticorps md6, anticorps fbw2, anticorps fwd2, anticorps MGC53244, anticorps FBW2, anticorps Fwd2, anticorps Md6, anticorps wu:fc72f10, anticorps zgc:110365, anticorps 2700071L08Rik, anticorps MD6, anticorps F-box and WD repeat domain containing 2, anticorps F-box and WD repeat domain containing 2 L homeolog, anticorps F-box and WD-40 domain protein 2, anticorps FBXW2, anticorps fbxw2, anticorps Fbxw2, anticorps fbxw2.L

Sujet: F-box proteins are an expanding family of eukaryotic proteins characterized by an approximately 40 amino acid motif, the F box. Some F-box proteins have been shown to be critical for the ubiquitin-mediated degradation of cellular regulatory proteins. In fact, F-box proteins are one of the four subunits of ubiquitin protein ligases, called SCFs. SCF ligases bring ubiquitin conjugating enzymes to substrates that are specifically recruited by the different F-box proteins.

Poids moléculaire: 51 kDa (MW of target protein)