FBXO4 anticorps (Middle Region)
-
- Antigène Voir toutes FBXO4 Anticorps
- FBXO4 (F-Box Protein 4 (FBXO4))
-
Épitope
- Middle Region
-
Reactivité
- Humain
-
Hôte
- Lapin
-
Clonalité
- Polyclonal
-
Conjugué
- Cet anticorp FBXO4 est non-conjugé
-
Application
- Western Blotting (WB)
- Specificité
- FBXO4 antibody was raised against the middle region of FBXO4
- Purification
- Affinity purified
- Immunogène
- FBXO4 antibody was raised using the middle region of FBXO4 corresponding to a region with amino acids TSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKSK
- Top Product
- Discover our top product FBXO4 Anticorps primaire
-
anti-F-Box Protein 4 (FBXO4) (AA 138-387) antibody
FBXO4 Reactivité: Humain WB, ELISA, IP, IHC Hôte: Lapin Polyclonal unconjugated
anti-F-Box Protein 4 (FBXO4) (AA 1-387) antibodyFBXO4 Reactivité: Humain WB, IP Hôte: Lapin Polyclonal unconjugated
anti-F-Box Protein 4 (FBXO4) (AA 201-500) antibodyFBXO4 Reactivité: Humain ELISA, IHC Hôte: Lapin Polyclonal unconjugated
anti-F-Box Protein 4 (FBXO4) (AA 1-387) antibodyFBXO4 Reactivité: Humain ELISA, IP, IF Hôte: Souris Monoclonal 2F2 unconjugated
anti-F-Box Protein 4 (FBXO4) (AA 225-251) antibodyFBXO4 Reactivité: Humain WB Hôte: Lapin Polyclonal RB23912 unconjugated
anti-F-Box Protein 4 (FBXO4) (AA 1-387) antibodyFBXO4 Reactivité: Humain WB Hôte: Souris Polyclonal unconjugated
anti-F-Box Protein 4 (FBXO4) (Internal Region) antibodyVerified FBXO4 Reactivité: Humain ELISA, IHC Hôte: Chèvre Polyclonal unconjugated
anti-F-Box Protein 4 (FBXO4) (Internal Region) antibodyVerified FBXO4 Reactivité: Humain WB, ELISA Hôte: Chèvre Polyclonal unconjugated
anti-F-Box Protein 4 (FBXO4) (C-Term) antibodyFBXO4 Reactivité: Humain, Souris, Rat, Boeuf (Vache), Chien, Cheval, Cobaye WB Hôte: Lapin Polyclonal unconjugated
anti-F-Box Protein 4 (FBXO4) (C-Term) antibodyFBXO4 Reactivité: Humain, Boeuf (Vache), Chien, Cheval, Porc, Lapin, Roussette (Chauve-souris), Singe WB Hôte: Lapin Polyclonal unconjugated
-
- Indications d'application
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Commentaires
-
FBXO4 Blocking Peptide, catalog no. 33R-9277, is also available for use as a blocking control in assays to test for specificity of this FBXO4 antibody
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO4 antibody in PBS
- Concentration
- Lot specific
- Buffer
- PBS
- Conseil sur la manipulation
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Stock
- 4 °C/-20 °C
- Stockage commentaire
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Antigène
- FBXO4 (F-Box Protein 4 (FBXO4))
- Autre désignation
- FBXO4 (FBXO4 Produits)
- Synonymes
- anticorps FBX4, anticorps 1700096C12Rik, anticorps AI851261, anticorps AW494535, anticorps Fbx4, anticorps FBXO4, anticorps fbx4, anticorps si:dkey-46a10.2, anticorps F-box protein 4, anticorps F-box protein 4 L homeolog, anticorps FBXO4, anticorps Fbxo4, anticorps fbxo4, anticorps fbxo4.L
- Sujet
- FBXO4 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO4 belongs to the Fbxs class.
- Poids moléculaire
- 35 kDa (MW of target protein)
-
