FBXO4 anticorps (Middle Region)

N° du produit ABIN631364

L’anticorps anti-FBXO4 Polyclonal Lapin est utilisé pour la détection de FBXO4 dans des échantillons de Humain. Il a été validé pour WB.

Aperçu rapide pour FBXO4 anticorps (Middle Region) (ABIN631364)

Antigène: FBXO4 (F-Box Protein 4 (FBXO4))

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO4 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-FBXO4 anticorps

Épitope: Middle Region

Specificité: FBXO4 antibody was raised against the middle region of FBXO4

Purification: Affinity purified

Immunogène: FBXO4 antibody was raised using the middle region of FBXO4 corresponding to a region with amino acids TSAVNKMFSRHNEGDDQQGSRYSVIPQIQKVCEVVDGFIYVANAEAHKSK

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO4 Blocking Peptide, (ABIN5613549), is also available for use as a blocking control in assays to test for specificity of this FBXO4 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO4

Antigène: FBXO4 (F-Box Protein 4 (FBXO4))

Autre désignation: FBXO4

Sujet: FBXO4 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of the ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box), which function in phosphorylation-dependent ubiquitination. The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXO4 belongs to the Fbxs class.

Poids moléculaire: 35 kDa (MW of target protein)