RNF115 anticorps (C-Term)

N° du produit ABIN631370

Détail du produit anti-RNF115 anticorps

Antigène: RNF115 (Ring Finger Protein 115 (RNF115))

Épitope: C-Term

Reactivité: Humain, Souris

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF115 est non-conjugé

Application: Western Blotting (WB)

Specificité: ZNF364 antibody was raised against the C terminal Of Znf364

Purification: Affinity purified

Immunogène: ZNF364 antibody was raised using the C terminal Of Znf364 corresponding to a region with amino acids PWLELHDTCPVCRKSLNGEDSTRQSQSTEASASNRFSNDSQLHDRWTF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

ZNF364 Blocking Peptide, catalog no. 33R-7433, is also available for use as a blocking control in assays to test for specificity of this ZNF364 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ZNF364 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF115

Antigène: RNF115 (Ring Finger Protein 115 (RNF115))

Autre désignation: ZNF364 (RNF115 Produits)

Synonymes: anticorps BCA2, anticorps ZNF364, anticorps 2610028E05Rik, anticorps AU042696, anticorps Zfp364, anticorps ring finger protein 115, anticorps RNF115, anticorps Rnf115

Sujet: ZNF364 contains 1 RING-type zinc finger. The exact function of ZNF364 remains unknown.

Poids moléculaire: 34 kDa (MW of target protein)