FBXO21 anticorps (N-Term)

N° du produit ABIN631372

Détail du produit anti-FBXO21 anticorps

Antigène: FBXO21 (F-Box Protein 21 (FBXO21))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp FBXO21 est non-conjugé

Application: Western Blotting (WB)

Specificité: FBXO21 antibody was raised against the N terminal of FBXO21

Purification: Affinity purified

Immunogène: FBXO21 antibody was raised using the N terminal of FBXO21 corresponding to a region with amino acids KEQFRVRWPSLMKHYSPTDYVNWLEEYKVRQKAGLEARKIVASFSKRFFS

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

FBXO21 Blocking Peptide, catalog no. 33R-4350, is also available for use as a blocking control in assays to test for specificity of this FBXO21 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FBXO21 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur FBXO21

Antigène: FBXO21 (F-Box Protein 21 (FBXO21))

Autre désignation: FBXO21 (FBXO21 Produits)

Synonymes: anticorps FBX21, anticorps 2810425J22Rik, anticorps AU016673, anticorps mKIAA0875, anticorps si:ch211-42a13.2, anticorps F-box protein 21, anticorps FBXO21, anticorps Fbxo21, anticorps fbxo21

Sujet: FBXO21 contains 1 F-box domain. It is a substrate-recognition component of the SCF (SKP1-CUL1-F-box protein)-type E3 ubiquitin ligase complex.

Poids moléculaire: 71 kDa (MW of target protein)