TRIM49 anticorps (N-Term)

N° du produit ABIN631376

Détail du produit anti-TRIM49 anticorps

Antigène: TRIM49 (Tripartite Motif Containing 49 (TRIM49))

Épitope: N-Term

Reactivité: Humain

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp TRIM49 est non-conjugé

Application: Western Blotting (WB)

Specificité: TRIM49 antibody was raised against the N terminal of TRIM49

Purification: Affinity purified

Immunogène: TRIM49 antibody was raised using the N terminal of TRIM49 corresponding to a region with amino acids RPCFYLNWQDIPFLVQCSECTKSTEQINLKTNIHLKKMASLARKVSLWLF

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

TRIM49 Blocking Peptide, catalog no. 33R-8089, is also available for use as a blocking control in assays to test for specificity of this TRIM49 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM49 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur TRIM49

Antigène: TRIM49 (Tripartite Motif Containing 49 (TRIM49))

Autre désignation: TRIM49 (TRIM49 Produits)

Synonymes: anticorps RNF18, anticorps TRIM49A, anticorps TRIM49L2, anticorps tripartite motif containing 49, anticorps TRIM49

Sujet: TRIM49 contains a RING zinc finger, a motif known to be involved in protein-protein interactions. This protein has been found to be preferentially expressed in testis.

Poids moléculaire: 53 kDa (MW of target protein)