RNF25 anticorps (Middle Region)

N° du produit ABIN631379

Détail du produit anti-RNF25 anticorps

Antigène: RNF25 (Ring Finger Protein 25 (RNF25))

Épitope: Middle Region

Reactivité: Humain, Chien

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF25 est non-conjugé

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Specificité: RNF25 antibody was raised against the middle region of RNF25

Purification: Affinity purified

Immunogène: RNF25 antibody was raised using the middle region of RNF25 corresponding to a region with amino acids CREPLVYDLASLKAAPEPQQPMELYQPSAESLRQQEERKRLYQRQQERGG

Information d'application

Indications d'application: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

RNF25 Blocking Peptide, catalog no. 33R-1793, is also available for use as a blocking control in assays to test for specificity of this RNF25 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RNF25 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF25

Antigène: RNF25 (Ring Finger Protein 25 (RNF25))

Autre désignation: RNF25 (RNF25 Produits)

Synonymes: anticorps AO7, anticorps 0610009H16Rik, anticorps ring finger protein 25, anticorps RNF25, anticorps Rnf25

Sujet: RNF25 contains a RING finger motif. The mouse counterpart of this protein has been shown to interact with Rela, the p65 subunit of NF-kappaB (NFKB), and modulate NFKB-mediated transcription activity. The mouse protein also binds ubiquitin-conjugating enzymes (E2s) and is a substrate for E2-dependent ubiquitination.

Poids moléculaire: 51 kDa (MW of target protein)