RNF219 anticorps (N-Term)

N° du produit ABIN631380

Cet anticorps anti-RNF219 Polyclonal Lapin (ABIN631380) détecte spécifiquement RNF219 dans WB. L’anticorps est réactif avec des échantillons de Humain, Souris et Rat.

Aperçu rapide pour RNF219 anticorps (N-Term) (ABIN631380)

Antigène: RNF219 (Ring Finger Protein 219 (RNF219))

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp RNF219 est non-conjugé

Application: Western Blotting (WB)

Détail du produit anti-RNF219 anticorps

Épitope: N-Term

Specificité: C13 ORF7 antibody was raised against the N terminal Of C13 rf7

Purification: Affinity purified

Immunogène: C13 ORF7 antibody was raised using the N terminal Of C13 rf7 corresponding to a region with amino acids LVTDNPSKINPETVAEWKKKLRTANEIYEKVKDDVDKLKEANKKLKLENG

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

C13ORF7 Blocking Peptide, (ABIN5612403), is also available for use as a blocking control in assays to test for specificity of this C13ORF7 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF7 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur RNF219

Antigène: RNF219 (Ring Finger Protein 219 (RNF219))

Autre désignation: C13ORF7

Sujet: The function of C13orf7 has not been widely studied, and is yet to be fully elucidated.

Poids moléculaire: 80 kDa (MW of target protein)