LONRF3 anticorps (N-Term)

N° du produit ABIN631381

Détail du produit anti-LONRF3 anticorps

Antigène: LONRF3 (LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3))

Épitope: N-Term

Reactivité: Humain, Souris, Rat

Hôte: Lapin

Clonalité: Polyclonal

Conjugué: Cet anticorp LONRF3 est non-conjugé

Application: Western Blotting (WB)

Specificité: LONRF3 antibody was raised against the N terminal of LONRF3

Purification: Affinity purified

Immunogène: LONRF3 antibody was raised using the N terminal of LONRF3 corresponding to a region with amino acids QPPPPLRVNVVLSGLLGKLFPGPARASQLRHEGNRLYRERQVEAALLKYN

Information d'application

Indications d'application: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Commentaires:

LONRF3 Blocking Peptide, catalog no. 33R-7681, is also available for use as a blocking control in assays to test for specificity of this LONRF3 antibody

Restrictions: For Research Use only

Stockage

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LONRF3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Conseil sur la manipulation: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Stock: 4 °C/-20 °C

Stockage commentaire: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Détails sur LONRF3

Antigène: LONRF3 (LON Peptidase N-terminal Domain and Ring Finger 3 (LONRF3))

Autre désignation: LONRF3 (LONRF3 Produits)

Synonymes: anticorps RNF127, anticorps 4932412G04Rik, anticorps 5730439E01Rik, anticorps A830039N02Rik, anticorps AU023707, anticorps Rnf127, anticorps RGD1565451, anticorps LON peptidase N-terminal domain and ring finger 3, anticorps LONRF3, anticorps Lonrf3

Sujet: LONRF3 contains a RING finger domain, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions. Multiple alternatively spliced transcript variants have been suggested, but their full length natures are not clear.

Poids moléculaire: 84 kDa (MW of target protein)